PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma89g00440.1
Common NameZOSMA_89G00440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 193aa    MW: 22078.6 Da    PI: 10.503
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma89g00440.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.3e-29959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien+ nrqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gk y +s+
  Zosma89g00440.1  9 KRIENNLNRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPSGKAYQFSN 59
                     79***********************************************85 PP

2K-box53.11.3e-1881162990
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                      ++++  e ++ e+++Lkk   + +  ++h+ G+dL s  ++e++qLe+q+ ++l++iR++K +l++++i+ l+kk ++   +
  Zosma89g00440.1  81 QDTRGIECWRIEVENLKKLAVSSEARIKHMCGDDLASVGMREIKQLERQMRTGLQRIRAQKRRLVTDHIKMLKKKDENSYLQ 162
                      566778999******************************************************************9886544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.366161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-32278IPR002100Transcription factor, MADS-box
CDDcd002651.57E-39270No hitNo description
PRINTSPR004048.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.58186171IPR002487Transcription factor, K-box
PfamPF014861.6E-1586159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRGKVELKR IENNLNRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP SGKAYQFSNN  60
DIDMTISRYR SLGGLPDLND QDTRGIECWR IEVENLKKLA VSSEARIKHM CGDDLASVGM  120
REIKQLERQM RTGLQRIRAQ KRRLVTDHIK MLKKKDENSY LQRRMQEACK AMEAKNLETI  180
PHAPSAGRFN LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-21271170Myocyte-specific enhancer factor 2A
3mu6_C2e-21271170Myocyte-specific enhancer factor 2A
3mu6_B2e-21271170Myocyte-specific enhancer factor 2A
3mu6_A2e-21271170Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321711.16e-73putative transcription factor family protein
TrEMBLA0A0K9NLX41e-141A0A0K9NLX4_Z
STRINGVIT_17s0000g01230.t014e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4174523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-43AGAMOUS-like 6